PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00002838-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 65aa    MW: 7594.48 Da    PI: 4.4065
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00002838-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.11.3e-101558146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        ++ ++++E+ l v  +++ G + W++Ia +++ gRt++++  +w++
  WALNUT_00002838-RA 15 KLQFSEDEETLVVIMFNLVGER-WSLIAGRIP-GRTAEEIEKYWNS 58
                        6789****************99.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3511064IPR017930Myb domain
SMARTSM007171.0E-51462IPR001005SANT/Myb domain
PfamPF002494.4E-91658IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-121759IPR009057Homeodomain-like
SuperFamilySSF466891.09E-81761IPR009057Homeodomain-like
CDDcd001675.25E-61857No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 65 aa     Download sequence    Send to blast
MSLLEAENNM NHESKLQFSE DEETLVVIMF NLVGERWSLI AGRIPGRTAE EIEKYWNSRY  60
SSKSE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267669.19e-28PREDICTED: MYB-like transcription factor ETC1
SwissprotQ9LNI57e-16ETC1_ARATH; MYB-like transcription factor ETC1
TrEMBLE0CVL21e-27E0CVL2_VITVI; Putative uncharacterized protein
STRINGVIT_10s0116g00500.t013e-27(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01380.14e-17MYB_related family protein